DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33108 and K07A1.3

DIOPT Version :9

Sequence 1:NP_788728.1 Gene:CG33108 / 326257 FlyBaseID:FBgn0053108 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_492543.2 Gene:K07A1.3 / 172795 WormBaseID:WBGene00010610 Length:232 Species:Caenorhabditis elegans


Alignment Length:206 Identity:64/206 - (31%)
Similarity:97/206 - (47%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GCYLSRVCQYTPPKHCQYYSVNSIV---QVGPTCGLVALSMLL---GGSPTADDLLKDAIDQEYT 110
            |.:..:||..|          |.|.   |.||||||||:||.|   |.....:.:|:.|.:..:|
 Worm    23 GEFGGQVCLNT----------NKITPRQQKGPTCGLVAISMCLEHFGIKTNPETILEKAKEMGFT 77

  Fly   111 LNGELFSAQYLFELTRKHMPGPAACQLHVGPLDCKKVKELLKAGGCLLVPYDADVNHAPCVKNGH 175
            ..||::||:.|..||.:.:|..:..:....|   |:..:.:..|..:|:.||...|:.|....||
 Worm    78 KQGEMYSAESLASLTNEFLPNSSKIRKMPSP---KEFTQSICDGKQMLIAYDCGPNYQPVYVRGH 139

  Fly   176 RAHWALIVGYL--------VDTQ------DRFYVLARHGKSRNLAVWPLDTLSQSNENLKEFAQP 226
            .|||.|..|::        |:|:      |...::...|||.||.|:|.:.:..||..|.| |..
 Worm   140 SAHWLLACGFVKKQEVDGFVETRETVAETDEIAIIGYQGKSTNLNVFPFNEVVASNAQLLE-AGL 203

  Fly   227 KGYPDDEFLLP 237
            |..| .|:::|
 Worm   204 KRDP-SEYIIP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33108NP_788728.1 None
K07A1.3NP_492543.2 Peptidase_C39_like 39..>88 CDD:381927 20/48 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3778
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48886
OrthoDB 1 1.010 - - D1549432at2759
OrthoFinder 1 1.000 - - FOG0006874
OrthoInspector 1 1.000 - - oto17899
orthoMCL 1 0.900 - - OOG6_107979
Panther 1 1.100 - - LDO PTHR28631
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4809
SonicParanoid 1 1.000 - - X4980
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.900

Return to query results.
Submit another query.