DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33108 and lsm3

DIOPT Version :9

Sequence 1:NP_788728.1 Gene:CG33108 / 326257 FlyBaseID:FBgn0053108 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001373759.1 Gene:lsm3 / 100535720 ZFINID:ZDB-GENE-161207-2 Length:102 Species:Danio rerio


Alignment Length:44 Identity:9/44 - (20%)
Similarity:23/44 - (52%) Gaps:10/44 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LSMLLGGSPTADDLLKDAIDQEYTLNGELFSAQYLFELTRKHMP 130
            |:|:||  ...:.:....||:|        :.:.:::.|::::|
Zfish    50 LNMILG--DVEETVTTVEIDEE--------TYEEIYKSTKRNIP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33108NP_788728.1 None
lsm3NP_001373759.1 LSm3 16..97 CDD:212477 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3460
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.