powered by:
Protein Alignment CG33108 and lsm3
DIOPT Version :9
Sequence 1: | NP_788728.1 |
Gene: | CG33108 / 326257 |
FlyBaseID: | FBgn0053108 |
Length: | 267 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373759.1 |
Gene: | lsm3 / 100535720 |
ZFINID: | ZDB-GENE-161207-2 |
Length: | 102 |
Species: | Danio rerio |
Alignment Length: | 44 |
Identity: | 9/44 - (20%) |
Similarity: | 23/44 - (52%) |
Gaps: | 10/44 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 LSMLLGGSPTADDLLKDAIDQEYTLNGELFSAQYLFELTRKHMP 130
|:|:|| ...:.:....||:| :.:.:::.|::::|
Zfish 50 LNMILG--DVEETVTTVEIDEE--------TYEEIYKSTKRNIP 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33108 | NP_788728.1 |
None |
lsm3 | NP_001373759.1 |
LSm3 |
16..97 |
CDD:212477 |
9/44 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3460 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.