DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33108 and c19orf54

DIOPT Version :9

Sequence 1:NP_788728.1 Gene:CG33108 / 326257 FlyBaseID:FBgn0053108 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_012823439.1 Gene:c19orf54 / 100144997 XenbaseID:XB-GENE-5907400 Length:328 Species:Xenopus tropicalis


Alignment Length:295 Identity:89/295 - (30%)
Similarity:135/295 - (45%) Gaps:55/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPPPPPMI-VTPSTPATTK-ERPVGDNITTDECTWACEYPEVQKGCYLSRVCQYTPPKHCQYYS 71
            ||.||||.| :.|.|.|..| .:.|.:|  :|..|..||  |::| ...:|..::........|:
 Frog    47 PPLPPPPQIHLLPPTVAKCKFFKKVAEN--SDPSTGGCE--ELKK-MIKNRQSRFNGELKWLLYN 106

  Fly    72 --VNSIVQVGPTCGLVALSML-----LGGSPTADDLLKDAIDQEYTLNGELFSAQYLFELTRKHM 129
              |.|::|.||.||||||.|.     |........:::.|:.:.||..||:|||..:..|.::..
 Frog   107 QYVPSLIQEGPQCGLVALWMAGKLLNLAHEAPLQTIVEAAVSRGYTAQGEMFSAANMAVLAKEVF 171

  Fly   130 PGPAAC--QLHVGPLDCK---KVKELLKAGGCLLVPYDADVNHAPCVKNGHRAHWALIVGYLVDT 189
                .|  :|..|.:|.:   |:.:.|.:|..:|:|||.|.||.||.:.|||||||:|.|.|...
 Frog   172 ----GCRSELLTGGMDGENKGKILQQLTSGLPVLIPYDEDFNHEPCQREGHRAHWAVISGVLFGV 232

  Fly   190 Q----------------------------DRFYVLARHGKSRNLAVWPLDTLSQSNENLKEFAQP 226
            :                            ...|::|:.|||....:|..|.:|:||..|......
 Frog   233 RCGSFSPDPDIPGLCYPSSDSPSLEDLNIQEIYLVAKQGKSLRYQLWEYDCISRSNGQLIHLDPK 297

  Fly   227 KGYPDDEFLLPPGGIGGSLGLNERCILVNGLPKQV 261
            :....:.:::|.||:  ..||..:.:|..  ||.|
 Frog   298 RSNDGNVYIVPSGGV--KAGLCGQIVLFQ--PKDV 328



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6552
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4803
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549432at2759
OrthoFinder 1 1.000 - - FOG0006874
OrthoInspector 1 1.000 - - oto104204
Panther 1 1.100 - - LDO PTHR28631
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4809
SonicParanoid 1 1.000 - - X4980
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.