DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33107 and B0491.7

DIOPT Version :9

Sequence 1:NP_788717.1 Gene:CG33107 / 326256 FlyBaseID:FBgn0053107 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_496427.1 Gene:B0491.7 / 174737 WormBaseID:WBGene00007194 Length:274 Species:Caenorhabditis elegans


Alignment Length:189 Identity:41/189 - (21%)
Similarity:73/189 - (38%) Gaps:48/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVEVDEMRLGYDHESIMSFLRKSSIKHLF---PYAAETTDGKQLLNRMMATLAGKLELNLQQL-- 71
            ::|.|...:..:.::|::...|..:..|.   |:.| ||....:|......:..|:..|...:  
 Worm    56 IIEADRTVVEQESDAILNGADKEDVALLVVGDPFGA-TTHADLVLRAKQQNIPVKVIHNASIMNA 119

  Fly    72 -----LDLF----TLSIMMMTYQ------RDNVLLMKERYMMVDVVCHLAESLDSEEMFYMASGL 121
                 |.|:    |:||:|.|.:      .|.:.|.::|.|  ..:|.|  .:.::|.      .
 Worm   120 VGCCGLQLYNFGETVSIVMWTDEWQPESYYDKIALNRKRGM--HTLCLL--DIKTKEQ------T 174

  Fly   122 YENLITGVGMERLERVLDLQAAIPAMVESCHLGNDVAMALLLTIMGR--YTGEPVELDQ 178
            .||::.|      .::.:     ||..:.|    ..|...||||..|  ..||....|:
 Worm   175 VENMMRG------RKIFE-----PARYQKC----SEAARQLLTIYERRKAKGEECAYDE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33107NP_788717.1 None
B0491.7NP_496427.1 PTZ00175 1..273 CDD:185500 41/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.