DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and EIF4E2

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_004837.1 Gene:EIF4E2 / 9470 HGNCID:3293 Length:245 Species:Homo sapiens


Alignment Length:133 Identity:62/133 - (46%)
Similarity:89/133 - (66%) Gaps:2/133 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPGENRLQHTYCLWFSRKETQR--AAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELL 104
            ||.|:.||:.|..|:||:...|  ::..|.:::..:|..|||:|:|..|||::||..|..:.:..
Human    50 GPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFH 114

  Fly   105 LFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPS 169
            |||:||.|||||.||..||:|:|||||....|.|||:.:|||||||:||:||||.|:..::....
Human   115 LFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI 179

  Fly   170 IQV 172
            |.:
Human   180 ISI 182

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 57/123 (46%)
EIF4E2NP_004837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 1/1 (100%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000269|PubMed:17368478 54..57 0/2 (0%)
IF4E 55..214 CDD:396291 59/128 (46%)