DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and NCBP

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_197312.1 Gene:NCBP / 831929 AraportID:AT5G18110 Length:221 Species:Arabidopsis thaliana


Alignment Length:168 Identity:47/168 - (27%)
Similarity:88/168 - (52%) Gaps:13/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIVDSDDSDVDNQIDVDNLP-------------PLEVGPGENRLQHTYCLWFSRKETQRAAADYS 69
            :::|..|.::.:..::|::.             ..|:..|::.|::.:.:|::|:........|.
plant     2 EVLDRRDDEIRDSGNMDSIKSHYVTDSVSEERRSRELKDGDHPLRYKFSIWYTRRTPGVRNQSYE 66

  Fly    70 KSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKV 134
            .::..:...::|:.:|:.|.||.|.:.|....:|..||.||.|:|||.||..||:|:||..|...
plant    67 DNIKKMVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEDGANCNGGKWIIRFSKVVS 131

  Fly   135 DRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPSIQV 172
            .|.||::.:|::|:|....|.|||.||..::....|.|
plant   132 ARFWEDLLLALVGDQLDDADNICGAVLSVRFNEDIISV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 40/121 (33%)
NCBPNP_197312.1 IF4E 44..201 CDD:366742 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H129059
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0004798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 1 1.100 - - LDO PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3380
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.