DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and EIF4E

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_193538.1 Gene:EIF4E / 827529 AraportID:AT4G18040 Length:235 Species:Arabidopsis thaliana


Alignment Length:176 Identity:49/176 - (27%)
Similarity:89/176 - (50%) Gaps:13/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMEKVANKQYETKNWPDIVDSDDSDV-----DNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKET 61
            |:|...::.:|..:     |:::.::     |..:|..:...:   |..:.|:|::..||.....
plant    19 SIENPIDRYHEEGD-----DAEEGEIAGGEGDGNVDESSKSGV---PESHPLEHSWTFWFDNPAV 75

  Fly    62 QRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWL 126
            :.....:..||..|...::|:::||||:::..|:.|....:...||..|.|.||||..:.||:|.
plant    76 KSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWT 140

  Fly   127 IRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPSIQV 172
            :...|.|.|::|....:|::||||..||||||.|:..:.....|.:
plant   141 MTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 41/121 (34%)
EIF4ENP_193538.1 IF4E 61..216 CDD:396291 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.