DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and eif4e2

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001016076.1 Gene:eif4e2 / 548830 XenbaseID:XB-GENE-5823950 Length:212 Species:Xenopus tropicalis


Alignment Length:157 Identity:68/157 - (43%)
Similarity:100/157 - (63%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAA--DYSKSLHMVGRCAS 80
            |:..::|....:|    .:..:.|.|||:.||:.|..|:||:...|.|:  :|.:::...|..||
 Frog     8 DLTTAEDDFTKSQ----KVKEVMVPPGEHPLQYKYTFWYSRRTPSRPASTHNYEQNIRQFGTVAS 68

  Fly    81 VQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAM 145
            |:|:|.:|||::||..|..|.:..|||.||.|||||.||..||:|:|||||....|.|||:.:||
 Frog    69 VEQFWRIYSHIVRPGDLTGYSDFHLFKDGIKPMWEDEANKNGGKWIIRLRKGLASRFWENIILAM 133

  Fly   146 LGEQFLVGDEICGVVLQTKYPNPSIQV 172
            |||||:||:||||||:..::....:.:
 Frog   134 LGEQFMVGEEICGVVVSIRFQEDILSI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 59/123 (48%)
eif4e2NP_001016076.1 IF4E 33..192 CDD:396291 61/128 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4761
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H129059
Inparanoid 1 1.050 146 1.000 Inparanoid score I4324
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0004798
OrthoInspector 1 1.000 - - otm48323
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2584
SonicParanoid 1 1.000 - - X3380
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.