DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and eif4e3

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001016049.1 Gene:eif4e3 / 548803 XenbaseID:XB-GENE-992071 Length:218 Species:Xenopus tropicalis


Alignment Length:199 Identity:44/199 - (22%)
Similarity:82/199 - (41%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTA 96
            |.:.:|          |...:..|..|......||:...:|..:....::|.:||:|:::.:.|.
 Frog    37 DTEGIP----------LHSPWTFWLDRSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPQVTN 91

  Fly    97 LKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF----LVGDEIC 157
            |.......|.:....|:||:.:|:|||.|.:::.|......|:.:.:|.:||||    ...||:.
 Frog    92 LPLRWSYHLMRGERKPLWEEESNAKGGVWKMKVPKEASSLVWKELLLATIGEQFTDRCAPEDEVI 156

  Fly   158 GVVLQTKYPNPSIQVACSSRPIICIIYTRFVVQFGKCKIIIVTNNNKRNVYEFL-----TIIVIK 217
            ||.:..:.....:||...:..::           |:..::       ..:||.|     ..:..|
 Frog   157 GVSVSVRDREDVVQVWNGNASVV-----------GEATVL-------EKIYELLPNTSFKAVFYK 203

  Fly   218 IHEE 221
            .|||
 Frog   204 PHEE 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 31/125 (25%)
eif4e3NP_001016049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
IF4E 45..198 CDD:279921 37/170 (22%)