DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and eif4e2

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:174 Identity:72/174 - (41%)
Similarity:98/174 - (56%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSDDSDVDNQIDVDN--------------------LPPLEVGPGENRLQHTYCLWFSRKETQRAA 65
            ||.|.|.||....|.                    :|    |.||:.||:.|..|:||:...|.|
Zfish    12 DSGDHDQDNSSPKDGEKEKNDEEDKEANTTKRKAVVP----GAGEHPLQYNYTFWYSRRTPGRPA 72

  Fly    66 A--DYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIR 128
            :  .|.:::..:|..|||:|:|..|||:|||..|..:.:..|||:||.|||||.||..||:|:||
Zfish    73 STQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIIR 137

  Fly   129 LRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPSIQV 172
            |||....|.|||:.:|||||||:||:||||.|:..::....|.:
Zfish   138 LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 59/123 (48%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 61/128 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573559
Domainoid 1 1.000 138 1.000 Domainoid score I4799
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4427
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0004798
OrthoInspector 1 1.000 - - otm24352
orthoMCL 1 0.900 - - OOG6_101698
Panther 1 1.100 - - LDO PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2584
SonicParanoid 1 1.000 - - X3380
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.