DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and eif4eb

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb / 493617 ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio


Alignment Length:172 Identity:49/172 - (28%)
Similarity:85/172 - (49%) Gaps:24/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPG---ENRLQHTYCLWFSRKETQRAAADYSK 70
            |....|:..:|.|..:.::             |.|.   ::.||:.:||||.:.:..:.   :..
Zfish     9 KSNSCKSEEEISDESNQEI-------------VSPESYIKHPLQNRWCLWFFKNDKSKT---WQA 57

  Fly    71 SLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRL----RK 131
            :|.::.:..:|:.:|:||:|:...:.|....:..|||.||.|||||..|.:||:|||.|    ||
Zfish    58 NLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQQRK 122

  Fly   132 NKVDRAWENVCMAMLGEQF-LVGDEICGVVLQTKYPNPSIQV 172
            ..:||.|....:.::||.| ...|::||.|:..:.....|.:
Zfish   123 YDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 41/126 (33%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 41/128 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.