DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and eIF4E1

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster


Alignment Length:160 Identity:48/160 - (30%)
Similarity:77/160 - (48%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PLEVG-PGEN-------------RLQHTY--------CLWFSRKETQRAAADYSKSLHMVGRCAS 80
            |.|.| |..|             |.:|.|        .||:...:..::..|....:....   :
  Fly    51 PQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFD---T 112

  Fly    81 VQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNK---VDRAWENVC 142
            |:.:||||:|:..|:.:|...:..|||:.|.|||||.||.:||:|:|.|.|:.   :|..|.:|.
  Fly   113 VEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVL 177

  Fly   143 MAMLGEQFLVGDEICGVVLQTKYPNPSIQV 172
            :.::||.|...|:|||.|:..:..:..|.:
  Fly   178 LCLIGEAFDHSDQICGAVINIRGKSNKISI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 42/132 (32%)
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 40/129 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.