DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and MGC89871

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001005099.1 Gene:MGC89871 / 448677 XenbaseID:XB-GENE-973579 Length:234 Species:Xenopus tropicalis


Alignment Length:133 Identity:62/133 - (46%)
Similarity:89/133 - (66%) Gaps:2/133 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPGENRLQHTYCLWFSRKETQR--AAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELL 104
            ||.|:.||:.|..|:||:...|  ::..|.:::..:|..|||:|:|..|||::||..|..:.:..
 Frog    50 GPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFH 114

  Fly   105 LFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPS 169
            |||:||.|||||.||..||:|:|||||....|.|||:.:|||||||:||:||||.|:..::....
 Frog   115 LFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI 179

  Fly   170 IQV 172
            |.:
 Frog   180 ISI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 57/123 (46%)
MGC89871NP_001005099.1 IF4E 55..214 CDD:366742 59/128 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4761
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4324
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0004798
OrthoInspector 1 1.000 - - otm48323
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3380
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.