DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and tif45

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_594228.1 Gene:tif45 / 2541706 PomBaseID:SPAC16E8.15 Length:218 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:39/148 - (26%)
Similarity:73/148 - (49%) Gaps:11/148 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYR-ELLLFKQGII 111
            |...:.|||....|  ...::::....:....||:::|.:::: |.|.:..|.: :...|::|:.
pombe    40 LARPWTLWFLMPPT--PGLEWNELQKNIITFNSVEEFWGIHNN-INPASSLPIKSDYSFFREGVR 101

  Fly   112 PMWEDPANSKGGQWLIRLR---KNKVDRAWENVCMAMLGEQF-LVGDEICGVVLQTKYPNPSIQV 172
            |.|||..|..||:|..:.:   .|.:|..|....:|.:||.. ..|.|:.|||:..:.....:.|
pombe   102 PEWEDVHNKTGGKWAFQNKGRGGNALDEMWLTTVLAAIGETLDPTGQEVMGVVINMRKGFYRLAV 166

  Fly   173 ---ACSSRPIICIIYTRF 187
               :|::|.::..|.|||
pombe   167 WTKSCNNREVLMEIGTRF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 31/126 (25%)
tif45NP_594228.1 CDC33 1..218 CDD:227386 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.