DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4EHP and ife-5

DIOPT Version :9

Sequence 1:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001379255.1 Gene:ife-5 / 174871 WormBaseID:WBGene00002063 Length:201 Species:Caenorhabditis elegans


Alignment Length:132 Identity:39/132 - (29%)
Similarity:64/132 - (48%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIP 112
            ||..:..||...:...:..|..|.::...   :|.::|:.|..::.|:.|....:..:|:..|.|
 Worm    11 LQRNWSWWFLNDDRNASWQDRLKKVYTFN---TVPEFWAFYEAILPPSGLNDLCDYNVFRDDIQP 72

  Fly   113 MWEDPANSKGGQWLIRLRKNK----VDRAWENVCMAMLGEQFLVG---DEICGVVLQTKYPNPSI 170
            .||.|.|..||:|||.:.|.|    :|..|..:.:|::||||  |   :.|||:|...:.....|
 Worm    73 KWEAPENWDGGRWLIIINKGKTPEVLDAVWLEILLALIGEQF--GKDMESICGLVCNVRGQGSKI 135

  Fly   171 QV 172
            .|
 Worm   136 SV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 36/128 (28%)
ife-5NP_001379255.1 IF4E 10..159 CDD:396291 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.