DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33098 and Myl7

DIOPT Version :10

Sequence 1:NP_788657.1 Gene:CG33098 / 326253 FlyBaseID:FBgn0053098 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_075017.2 Gene:Myl7 / 17898 MGIID:107495 Length:175 Species:Mus musculus


Alignment Length:144 Identity:45/144 - (31%)
Similarity:78/144 - (54%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 AKLAELKEVFSLFDTDCDGLISKDDLRFTYTALG--NEPNEQLLEQMMQEAKEPLDYEAFVRLMS 143
            |::.|.||.||..|.:.||:|.|.||:.||:.||  :.|.|: |:.|:||.|.|:::..|:.|..
Mouse    32 AQIQEFKEAFSCIDQNRDGIICKSDLKETYSQLGRVSVPEEE-LDAMLQEGKGPINFTVFLTLFG 95

  Fly   144 RRTQELDPEDVLLEAWSKWDDHGTGKIDERKIYEELTNYGDKMTLNEAKEALSHAPMAKPKSLEE 208
            .:....|||:.:|.|:..:|..|.|.:::.:..:.|....||.:..|.::..:..||      :.
Mouse    96 EKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLFALTPM------DL 154

  Fly   209 PPMIDYPAFCRMLS 222
            ...|||.:.|.:::
Mouse   155 AGNIDYKSLCYIIT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33098NP_788657.1 PTZ00184 75..221 CDD:185504 45/141 (32%)
Myl7NP_075017.2 PTZ00184 28..168 CDD:185504 45/142 (32%)

Return to query results.
Submit another query.