DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and YNL320W

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_014079.1 Gene:YNL320W / 855396 SGDID:S000005264 Length:284 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:67/240 - (27%)
Similarity:104/240 - (43%) Gaps:36/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TRTSRG------NLITCIYVRC------SKNAKYTLLFSHGNAVDLGQ----MSSFYLTLGSQIN 118
            |..|||      .|||..:::.      ::|:..|:|....||.::|.    :..||    .|..
Yeast    46 TPDSRGIPYEKLTLITQDHIKLEAWDIKNENSTSTVLILCPNAGNIGYFILIIDIFY----RQFG 106

  Fly   119 CNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLAS--R 181
            .::|.|.|.|||.|.|.||||.|..|.:.....:.|....|...::|||:|:|....:.:||  |
Yeast   107 MSVFIYSYRGYGNSEGSPSEKGLKLDADCVISHLSTDSFHSKRKLVLYGRSLGGANALYIASKFR 171

  Fly   182 HEVGAVILHSPLMSGLRV---VFRNTKR-------TWFFDAFPSIDKVAKVKAPVLVIHGTDDEV 236
            .....|||.:..:|..:|   :|...||       .|..:....   ....:.|.|.:.|..||:
Yeast   172 DLCDGVILENTFLSIRKVIPYIFPLLKRFTLLCHEIWNSEGLMG---SCSSETPFLFLSGLKDEI 233

  Fly   237 IDFSHGIGIYERCPKTVEPFWVEGAG-HNDVELHPHYYERLRKFL 280
            :...|...:||.||.:.:..:....| |||..:...|::.:|.||
Yeast   234 VPPFHMRKLYETCPSSNKKIFEFPLGSHNDTIIQDGYWDIIRDFL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 57/204 (28%)
YNL320WNP_014079.1 FrsA 1..281 CDD:223999 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I2653
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R134
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.