DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and YDL057W

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_010226.1 Gene:YDL057W / 851502 SGDID:S000002215 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:61/277 - (22%)
Similarity:89/277 - (32%) Gaps:111/277 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QPPEPTYKLTPADD-----TNIRYNLQLFDRAEWQYSEREKSKVEAFFTRTSRGNLITCIYVRCS 86
            |...|:|....|::     |:....|.....|...|.|:..|..    .....|.|:      |.
Yeast    11 QSAPPSYIKLEANEKFVYITSTMNGLSYQIAAIVSYPEKRNSST----ANKEDGKLL------CK 65

  Fly    87 KNAKYTLLF----SHGNAVDLGQMSSFYLTLGSQINCNIFGY-----DYSGYGMSG-------GK 135
            :| |..||.    ||.||:        |.||.:: ....|||     |:.|.|.|.       |:
Yeast    66 EN-KLALLLHGSQSHKNAI--------YQTLLAK-RLAEFGYWVLRIDFRGQGDSSDNCDPGLGR 120

  Fly   136 PSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHEVGAVI-------LH--- 190
            ...::| .|:...:|.:..|    ...:.||..|  |: ::|:...|..|::.       ||   
Yeast   121 TLAQDL-EDLSTVYQTVSDR----SLRVQLYKTS--TI-SLDVVVAHSRGSLAMFKFCLKLHAAE 177

  Fly   191 SPLMSGLRVVFRNTKRTWFFDAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEP 255
            |||.|.|                             :...|..|       |.|:.|||.:    
Yeast   178 SPLPSHL-----------------------------INCAGRYD-------GRGLIERCTR---- 202

  Fly   256 FWVEGAGHNDVELHPHY 272
                        ||||:
Yeast   203 ------------LHPHW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 46/207 (22%)
YDL057WNP_010226.1 Abhydrolase_6 71..290 CDD:403789 46/206 (22%)
Hydrolase_4 71..>172 CDD:403389 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.