DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and AT1G32190

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_174498.1 Gene:AT1G32190 / 840111 AraportID:AT1G32190 Length:422 Species:Arabidopsis thaliana


Alignment Length:274 Identity:112/274 - (40%)
Similarity:171/274 - (62%) Gaps:11/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CMFCCPPCPGPIAAKLAFQPPE-PTYKLTPADDTNIRYNLQLFDRAEWQYSEREKSKVEAFFTRT 72
            |||      ..:|||.||.||. |||.||...|..:. .:.....:...:.......::....:|
plant     3 CMF------SHLAAKFAFFPPSPPTYHLTKTPDGKLS-AVSSASSSSSTFPSAGDPSLDVKVVKT 60

  Fly    73 SRGNLITCIYVRCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPS 137
            .|||.:|..|:| :.||:.|||:|||||.||||:...::.|...:..|:.||||||||.|.||||
plant    61 RRGNKVTAFYLR-NPNARLTLLYSHGNAADLGQLFDLFVQLKVNLRVNLMGYDYSGYGASTGKPS 124

  Fly   138 EKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASR-HEVGAVILHSPLMSGLRVVF 201
            |.:.|||||||::.::|.:.:..|.:||||||:|:.||:.|||: ..:..|:|||.::|||||:.
plant   125 EYDTYADIEAAYECLQTDYGVGQEDLILYGQSVGSGPTLHLASKLPRLRGVVLHSGILSGLRVLC 189

  Fly   202 RNTKRTWFFDAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPFWVEGAGHNDV 266
             :.|..:..|.:.:::|:.|||.||||||||:|:|:::.||..:::...:..||.|::|.||.::
plant   190 -HVKFKFCCDIYSNVNKIKKVKCPVLVIHGTEDDVVNWLHGNRLWKMAKEPYEPLWIKGGGHCNL 253

  Fly   267 ELHPHYYERLRKFL 280
            |::|.|...|.:|:
plant   254 EIYPDYIRHLYRFI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 86/188 (46%)
AT1G32190NP_174498.1 FrsA 49..269 CDD:223999 96/221 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I1113
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000445
OrthoInspector 1 1.000 - - otm2524
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
88.010

Return to query results.
Submit another query.