DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and AT4G31020

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_194831.3 Gene:AT4G31020 / 829229 AraportID:AT4G31020 Length:294 Species:Arabidopsis thaliana


Alignment Length:274 Identity:119/274 - (43%)
Similarity:170/274 - (62%) Gaps:15/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IAAKLAFQPPEP-TYKLTPADDTNIRYNLQLFDRAEWQYSEREKSKVEAFFTRTSRGNLITCIYV 83
            :|||.||.|||| ||.:|..|:|.         :..:.....:|: ||.....|..||.:...:.
plant     8 VAAKFAFFPPEPATYGVTKDDETG---------KLVFAGVSADKN-VEVHQLTTKSGNKVVATFW 62

  Fly    84 RCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAA 148
            | ...|::|||:|||||.|||||...::.|.:.:..||..|||||||.|.|||||.|.|.||||.
plant    63 R-HPFARFTLLYSHGNAADLGQMVELFIELRAHLRVNIMSYDYSGYGASTGKPSEFNTYYDIEAV 126

  Fly   149 WQAMRTRFNISPETIILYGQSIGTVPTVDLASR-HEVGAVILHSPLMSGLRVVFRNTKRTWFFDA 212
            :..:|:.:.|..|.|||||||:|:.||:.:||| ..:..|:|||.::||:||:: ..|.|.:||.
plant   127 YSCLRSDYGIKQEEIILYGQSVGSGPTLHMASRLKRLRGVVLHSAILSGIRVLY-PVKMTLWFDI 190

  Fly   213 FPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPFWVEGAGHNDVELHPHYYERLR 277
            |.:|||:..|.:.|||||||:||::|.|||..::|...:..:|.||:|.||.::|.:|.|.:.|:
plant   191 FKNIDKIRHVNSQVLVIHGTNDEIVDLSHGKRLWELAKEKYDPLWVKGGGHCNLETYPEYIKHLK 255

  Fly   278 KFLSVELVKXQLKN 291
            ||::. :.| .|.|
plant   256 KFVNA-MEKLSLTN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 93/188 (49%)
AT4G31020NP_194831.3 FrsA <70..259 CDD:223999 94/189 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1805
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H26429
Inparanoid 1 1.050 235 1.000 Inparanoid score I1113
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000445
OrthoInspector 1 1.000 - - otm2524
orthoMCL 1 0.900 - - OOG6_100915
Panther 1 1.100 - - O PTHR12277
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.910

Return to query results.
Submit another query.