DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and AT3G01690

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_186818.1 Gene:AT3G01690 / 821094 AraportID:AT3G01690 Length:361 Species:Arabidopsis thaliana


Alignment Length:264 Identity:125/264 - (47%)
Similarity:167/264 - (63%) Gaps:14/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IAAKLAFQPPE-PTYKLTPADDTNIRYNLQLFDRAEWQYSEREKSKVEAFFTRTSRGNLITCIYV 83
            :|||.||.||. |:||:...:.|.:.. |..|...|         .||....||.||..|..:||
plant     8 VAAKFAFFPPSPPSYKVVTDELTGLLL-LSPFPHRE---------NVEIVKLRTRRGTEIVGMYV 62

  Fly    84 RCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAA 148
            | ...|..|||:|||||.|||||...::.|...:..|:.||||||||.|.|||||.|.||||||.
plant    63 R-HPMATSTLLYSHGNAADLGQMYELFIELSIHLKVNLMGYDYSGYGQSTGKPSEHNTYADIEAV 126

  Fly   149 WQAMRTRFNISPETIILYGQSIGTVPTVDLASR-HEVGAVILHSPLMSGLRVVFRNTKRTWFFDA 212
            ::.:...|....|.:||||||:|:.||:||||| .::.||:||||::|||||:: :.|:|::||.
plant   127 YKCLEETFGSKQEGVILYGQSVGSGPTLDLASRLPQLRAVVLHSPILSGLRVMY-SVKKTYWFDI 190

  Fly   213 FPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPFWVEGAGHNDVELHPHYYERLR 277
            :.:|||:..|..|||:||||.|||:|.|||..::|.|....||.||:|..|.|:|.:|.|...|:
plant   191 YKNIDKIPYVDCPVLIIHGTSDEVVDCSHGKQLWELCKDKYEPLWVKGGNHCDLEHYPEYIRHLK 255

  Fly   278 KFLS 281
            ||::
plant   256 KFIA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 99/188 (53%)
AT3G01690NP_186818.1 FrsA <54..261 CDD:223999 106/208 (51%)
PTZ00266 <268..>361 CDD:173502
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1805
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I1113
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000445
OrthoInspector 1 1.000 - - otm2524
orthoMCL 1 0.900 - - OOG6_100915
Panther 1 1.100 - - O PTHR12277
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.910

Return to query results.
Submit another query.