DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and AT2G24320

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001324569.1 Gene:AT2G24320 / 816968 AraportID:AT2G24320 Length:293 Species:Arabidopsis thaliana


Alignment Length:288 Identity:114/288 - (39%)
Similarity:172/288 - (59%) Gaps:20/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IAAKLAFQPPEPTYKLTPADDTNIRYNLQLFDRAEWQYSEREKSKVEAFFTRTSRGNLITCIYVR 84
            :|||.||.||.|||.:...::|.         :..:.....||| ::.....|..||.:...:.:
plant     8 MAAKFAFFPPPPTYDVGKDEETG---------KLMFTGITPEKS-MDVHQLTTKSGNKVIATFWK 62

  Fly    85 CSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAW 149
             ...:::|||:|||||.|||||...::.|.:.:..||..|||||||.|.|||:|.|.|.||||.:
plant    63 -HPFSRFTLLYSHGNAADLGQMVDLFIELRAHLRVNIMSYDYSGYGASTGKPTELNTYYDIEAVY 126

  Fly   150 QAMRTRFNISPETIILYGQSIGTVPTVDLASR-HEVGAVILHSPLMSGLRVVFRNTKRTWFFDAF 213
            ..:||.:.|..|.:||||||:|:.||:.|||| ..:..::|||.::|||||:: ..|.|::||.:
plant   127 NCLRTEYGIMQEEMILYGQSVGSGPTLHLASRVKRLRGIVLHSAILSGLRVLY-PVKMTFWFDMY 190

  Fly   214 PSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPFWVEGAGHNDVELHPHYYERLRK 278
            .:|||:..|..||||||||.|::::.|||..::|......:|.||:|.||.::|.:|.|.:.:||
plant   191 KNIDKIRHVTCPVLVIHGTKDDIVNMSHGKRLWELAKDKYDPLWVKGGGHCNLETYPEYIKHMRK 255

  Fly   279 FLSVELVKXQLKN------NVDGGVSDT 300
            |::. :.| .|.|      |.:..:.:|
plant   256 FMNA-MEKLALNNPPNKQQNDEPSIKET 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 91/188 (48%)
AT2G24320NP_001324569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H26429
Inparanoid 1 1.050 235 1.000 Inparanoid score I1113
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000445
OrthoInspector 1 1.000 - - otm2524
orthoMCL 1 0.900 - - OOG6_100915
Panther 1 1.100 - - O PTHR12277
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X362
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.910

Return to query results.
Submit another query.