DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and abhd12

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001070065.1 Gene:abhd12 / 767657 ZFINID:ZDB-GENE-060929-268 Length:382 Species:Danio rerio


Alignment Length:286 Identity:73/286 - (25%)
Similarity:112/286 - (39%) Gaps:86/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CPGPIAAKLAF-------------QPPEP------TYKLTPADDTNIRY----------NLQLFD 51
            ||. |.|||.|             :|.:.      .:.|.|.:..||..          ..|..|
Zfish    79 CPS-IQAKLVFLNFVRVPYFIDLKRPQDQGMNHTHNFYLQPEEGINIGVWHTVPAGMWREAQAKD 142

  Fly    52 RAEWQYSEREKSKVEAFFTRTSRGNLITCIYVRCSKNAKYTLLFSHGNAVDLG--QMSSFYLTLG 114
             |||                          |.:..:::...:|:.||||...|  .....|..| 
Zfish   143 -AEW--------------------------YEKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVL- 179

  Fly   115 SQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLA 179
            |.:..::..:||.|:|.|.|.|||:.:.:|....:|.::.|  |.|:.:.::|.|:||....:|.
Zfish   180 SSLGYHVVTFDYRGWGDSEGSPSERGMTSDALFLYQWIKQR--IGPKPLYIWGHSLGTGVATNLV 242

  Fly   180 SR-----HEVGAVILHSPLMSGLR---------VVFRNTKR-TWFF-DA-------FPSIDKVAK 221
            .|     ....|:||.|| .:.:|         :|:|.... .||| ||       |.|.:.|..
Zfish   243 RRLCDRGTPPDALILESP-FTNIREEAKSHPFSMVYRYLPGFDWFFLDAISANDIRFASDENVNH 306

  Fly   222 VKAPVLVIHGTDDEVIDFSHGIGIYE 247
            :..|||::|..||.|:.|..|..:|:
Zfish   307 ISCPVLILHAEDDTVVPFQLGKKLYD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 55/181 (30%)
abhd12NP_001070065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Hydrolase_4 151..340 CDD:378820 55/186 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.