DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and Acot4

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001102910.1 Gene:Acot4 / 681337 RGDID:1596753 Length:421 Species:Rattus norvegicus


Alignment Length:323 Identity:67/323 - (20%)
Similarity:102/323 - (31%) Gaps:100/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PIAAKLAFQPPEPTYKLTPAD-DTNIRYNLQLFDRAEWQYSER--------------------EK 62
            |:....|.:|..|.::|...| .|.....|::.|..|....:|                    .:
  Rat    77 PMGLLWAMEPERPFWRLIKRDVQTPFVVELEVLDGHEPDGGQRLARAVHERHFMAPGVRRVPVRE 141

  Fly    63 SKVEA-FFTRTSRGNL--ITCIYVRCSKNAKY--TLLFSHGNAVDLGQMSSFYLTLGSQINCNIF 122
            .:|.| .|....:|..  |..:|.......:|  :||..||.|.   ...:||.........|:.
  Rat   142 GRVRATLFLPPGQGPFPGIIDVYGVGGGLLEYRASLLAGHGFAT---LALAFYGFEDLPKEFNVI 203

  Fly   123 GYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLAS--RHEVG 185
            ..||                  .|.|...|.....:....|.|.|.|:|....:.:||  ::...
  Rat   204 EVDY------------------FEEAVCYMLQHPKVKGPDIGLLGLSLGADVCLIMASFLKNVSA 250

  Fly   186 AVILHSPLMSGLRVV-------------FRNTKRTWF---------FDAF-----PSIDKVAKVK 223
            .|.::....||.|.:             .|.||..:.         .||.     ||:..:.|.|
  Rat   251 TVSINGSAFSGNRYIHYKQTMIPPLGHDLRRTKVAFSGILDIVDIRNDAVGGCENPSMIPIEKAK 315

  Fly   224 APVLVIHGTDD-------------EVIDFSHGIGIYERCPKTVEPFWVEGAGHNDVELHPHYY 273
            .|:|.:.|.||             |.:. :||   .|| |:.:.   ..|.||   .:.|.|:
  Rat   316 GPILFVAGQDDHCWRSELYTQIASERLQ-AHG---KER-PQIIS---YPGTGH---YIEPPYF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 49/224 (22%)
Acot4NP_001102910.1 Bile_Hydr_Trans 17..137 CDD:282610 11/59 (19%)
BAAT_C 203..412 CDD:285986 41/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.