DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33096 and ACOT1

DIOPT Version :9

Sequence 1:	NP_001356926.1	Gene:	CG33096 / 326251	FlyBaseID:	FBgn0053096	Length:	349	Species:	Drosophila melanogaster
Sequence 2:	NP_001032238.1	Gene:	ACOT1 / 641371	HGNCID:	33128	Length:	421	Species:	Homo sapiens

Alignment Length:	119	Identity:	27/119 - (22%)
Similarity:	40/119 - (33%)	Gaps:	39/119 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   246 YERCPKTVEPFWVEGAGHNDVELHPHYYERLRKFLSVELVKXQLKNNVDG--GVS---------- 298
            ||..|||:|            .||..|:|....:|   |...::|....|  |:|
Human   193 YEDLPKTME------------TLHLEYFEEAVNYL---LSHPEVKGPGVGLLGISKGGELCLSMA 242

  Fly   299 ----DTTSGVISNSNPAAGSASLSSKHPNPAPAAGSETSKKNVDTNVKRIENDG 348
                ..|:.|:.|.:.|....:|..|        |.......|:.|..::..||
Human   243 SFLKGITAAVVINGSVANVGGTLRYK--------GETLPPVGVNRNRIKVTKDG 288

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33096	NP_001356926.1	FrsA	<92..280	CDD:223999	10/33 (30%)
ACOT1	NP_001032238.1	Bile_Hydr_Trans	16..137	CDD:377407
		Abhydrolase	138..>252	CDD:389770	17/73 (23%)
		BAAT_C	204..412	CDD:370148	20/96 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1073
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900