DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and BAAT

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001121082.1 Gene:BAAT / 570 HGNCID:932 Length:418 Species:Homo sapiens


Alignment Length:253 Identity:49/253 - (19%)
Similarity:80/253 - (31%) Gaps:81/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYG 167
            ||.:..|..:|.:..........|..|.....||...:|....|||...:|     .|:   ::|
Human   170 LGGLLEFRASLLASRGFASLALAYHNYEDLPRKPEVTDLEYFEEAANFLLR-----HPK---VFG 226

  Fly   168 QSIGTVPT-----VDLASR---HEVGAVIL------------------HSPLMSGLRVVFRN--- 203
            ..:|.|..     :.|:..   .:|.|.:|                  |.||....:::..|   
Human   227 SGVGVVSVCQGVQIGLSMAIYLKQVTATVLINGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALG 291

  Fly   204 ------TKRTWFFDAFPSIDKVAKVKAPVLVIHGTDDEVID----FSHGIGIYERCPKTVEPFWV 258
                  |..|....|...:..:.:.:...|.|.|..|:.|:    ....||..:|..|.   .|.
Human   292 LLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKN---NWT 353

  Fly   259 ----EGAGH---------------NDVELH------------PHYYERLRKFLSVELV 285
                .||||               :|:.||            .|.::.:::||...|:
Human   354 LLSYPGAGHLIEPPYSPLCCASTTHDLRLHWGGEVIPHAAAQEHAWKEIQRFLRKHLI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 46/246 (19%)
BAATNP_001121082.1 Bile_Hydr_Trans 14..140 CDD:377407
BAAT_C 207..412 CDD:370148 41/216 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.