Sequence 1: | NP_001356926.1 | Gene: | CG33096 / 326251 | FlyBaseID: | FBgn0053096 | Length: | 349 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121082.1 | Gene: | BAAT / 570 | HGNCID: | 932 | Length: | 418 | Species: | Homo sapiens |
Alignment Length: | 253 | Identity: | 49/253 - (19%) |
---|---|---|---|
Similarity: | 80/253 - (31%) | Gaps: | 81/253 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 LGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYG 167
Fly 168 QSIGTVPT-----VDLASR---HEVGAVIL------------------HSPLMSGLRVVFRN--- 203
Fly 204 ------TKRTWFFDAFPSIDKVAKVKAPVLVIHGTDDEVID----FSHGIGIYERCPKTVEPFWV 258
Fly 259 ----EGAGH---------------NDVELH------------PHYYERLRKFLSVELV 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33096 | NP_001356926.1 | FrsA | <92..280 | CDD:223999 | 46/246 (19%) |
BAAT | NP_001121082.1 | Bile_Hydr_Trans | 14..140 | CDD:377407 | |
BAAT_C | 207..412 | CDD:370148 | 41/216 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1073 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |