DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and abhd13

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001032774.1 Gene:abhd13 / 561333 ZFINID:ZDB-GENE-051120-54 Length:337 Species:Danio rerio


Alignment Length:251 Identity:74/251 - (29%)
Similarity:111/251 - (44%) Gaps:17/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAFFTRTSRG---NLITCIYVRCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYS 127
            |..:.||..|   |||...|...:.....|:|:.||||.::|......|.:...:..|:...||.
Zfish    87 ENVYIRTKDGIRLNLILLRYTGENPAGAPTILYFHGNAGNIGHRVPNALLMLVNLKANVVLVDYR 151

  Fly   128 GYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLAS--RHEVGAVILH 190
            |||.|.|.|||..||.|.||....:.||.:|....::|:|:|:|....:.|||  .|.|.|:::.
Zfish   152 GYGKSEGDPSEDGLYQDAEATLDYVMTRPDIDKTKVVLFGRSLGGAVAIRLASCNPHRVAAIMVE 216

  Fly   191 S-----PLMSGLRVVFRNTK--RTWFF-DAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYE 247
            :     |.|:.....|...:  ..|.: :.|.|...|...:.|.|.|.|..|::|.......:||
Zfish   217 NTFLSIPHMAATLFSFFPMRYLPLWCYKNKFLSYRHVVPCRMPSLFISGLSDQLIPPVMMKQLYE 281

  Fly   248 RCPKTVE--PFWVEGAGHNDVELHPHYYERLRKFLSVELVKXQLKNNVDGGVSDTT 301
            ..|...:  ..:.||. |||......|:..|.:|:. ||:| ..:.....|.:..|
Zfish   282 LSPSRTKRLAIFPEGT-HNDTWQCQGYFSALEQFMK-ELLKSHAREETTQGTASVT 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 60/199 (30%)
abhd13NP_001032774.1 FrsA <114..320 CDD:223999 63/207 (30%)
Abhydrolase_5 116..299 CDD:289465 55/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R134
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.