DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and acot18

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001188466.1 Gene:acot18 / 556673 ZFINID:ZDB-GENE-041210-254 Length:472 Species:Danio rerio


Alignment Length:185 Identity:36/185 - (19%)
Similarity:63/185 - (34%) Gaps:80/185 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADI-----EAAWQAM 152
            ||.|||.|    .|:..||:                       |.|... ||:     |.|:|.:
Zfish   229 LLASHGFA----SMALEYLS-----------------------PDELRT-ADVDVSYFENAYQIL 265

  Fly   153 RTRFNISPETIILYGQSIGTVPTVDLASRHEV----------GAVILHSPLMSGLRVVFRNTKRT 207
            :....:....:.:.|.|.|:..|..:|:...:          |:.::  |:...|..||...|: 
Zfish   266 QNHPKVQKNKMAMLGLSFGSAITFSMAAYSTIIKPQCCVCISGSHVV--PVDKSLFEVFEEIKK- 327

  Fly   208 WFFDAFPSIDK---------------------------VAKVKAPVLVIHGTDDE 235
                   ::||                           |.::|.||::::|.||:
Zfish   328 -------NMDKVHVNEDNHVIQRGMILPIPSDPAQKIDVGRIKCPVMLVNGGDDQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 36/185 (19%)
acot18NP_001188466.1 Bile_Hydr_Trans 63..189 CDD:282610
BAAT_C 253..465 CDD:285986 23/133 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.