DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and acot18

DIOPT Version :10

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001188466.1 Gene:acot18 / 556673 ZFINID:ZDB-GENE-041210-254 Length:472 Species:Danio rerio


Alignment Length:178 Identity:37/178 - (20%)
Similarity:62/178 - (34%) Gaps:66/178 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADI-----EAAWQAM 152
            ||.|||.|    .|:..||:                       |.|... ||:     |.|:|.:
Zfish   229 LLASHGFA----SMALEYLS-----------------------PDELRT-ADVDVSYFENAYQIL 265

  Fly   153 RTRFNISPETIILYGQSIGTVPTVDLASRHEV----------GAVILHSPLMSGLRVVFRNTKRT 207
            :....:....:.:.|.|.|:..|..:|:...:          |:.::  |:...|..||...|:.
Zfish   266 QNHPKVQKNKMAMLGLSFGSAITFSMAAYSTIIKPQCCVCISGSHVV--PVDKSLFEVFEEIKKN 328

  Fly   208 WF--------------------FDAFPSIDKVAKVKAPVLVIHGTDDE 235
            ..                    .|....|| |.::|.||::::|.||:
Zfish   329 MDKVHVNEDNHVIQRGMILPIPSDPAQKID-VGRIKCPVMLVNGGDDQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA 57..280 CDD:440691 37/178 (21%)
acot18NP_001188466.1 Bile_Hydr_Trans 62..193 CDD:461422
BAAT_C 253..465 CDD:430252 24/126 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.