DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and si:ch211-117n7.6

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_021328354.1 Gene:si:ch211-117n7.6 / 555902 ZFINID:ZDB-GENE-060503-474 Length:344 Species:Danio rerio


Alignment Length:205 Identity:50/205 - (24%)
Similarity:87/205 - (42%) Gaps:47/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KNAKY----------TLLFSHGNAVDLGQMSSFYLTLG-----SQINCNIFGYDYSGYGMSGGKP 136
            |||::          ..::.|||.   |..|:.: .:|     |.:..::...||.|:|.|.|:|
Zfish   104 KNAEWYEKALGDGSPIFIYLHGNG---GNRSALH-RIGVANVLSALGYHVLVMDYRGFGDSTGEP 164

  Fly   137 SEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASR-----HEVGAVILHSPLMSG 196
            :|..|..|....:..::.|...|  .:.::|.|||:..|.::|.:     .:...:||...::||
Zfish   165 TEPGLTTDALYLYNWIKKRSGNS--LVCVWGHSIGSGVTTNVAVKLLEEGKKFDGIILEGAMLSG 227

  Fly   197 LRVVFRNTKR--TWFFDAFPSI------------------DKVAKVKAPVLVIHGTDDEVIDFSH 241
             |...:....  :||:..||.|                  :.:.|::.|:|::|..||.|..||.
Zfish   228 -RAAAKQYGHPFSWFYWKFPYIQFFLFNPLKNNKIVFPLDENLEKIRTPILILHSKDDHVSPFSV 291

  Fly   242 GIGIYERCPK 251
            ...||....|
Zfish   292 AQEIYRIAKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 47/190 (25%)
si:ch211-117n7.6XP_021328354.1 AXE1 77..>171 CDD:331847 19/70 (27%)
Abhydrolase_1 138..316 CDD:331148 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.