DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33096 and Acot5

DIOPT Version :9

Sequence 1:	NP_001356926.1	Gene:	CG33096 / 326251	FlyBaseID:	FBgn0053096	Length:	349	Species:	Drosophila melanogaster
Sequence 2:	NP_001073177.1	Gene:	Acot5 / 503049	RGDID:	1565917	Length:	421	Species:	Rattus norvegicus

Alignment Length:	144	Identity:	33/144 - (22%)
Similarity:	55/144 - (38%)	Gaps:	49/144 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 PPE-PTYK-LTPAD--DTNIRYNLQLFDRAEW--QYSEREKSK-VEAFFTRTSR-------GNLI 78
            ||| |..| :.|.:  ||...:.:...|| .|  ::..||.|| ::|...:|.:       |:.|
  Rat   299 PPEGPDQKSIIPVERSDTTFLFLVSQDDR-NWKSEFYAREASKRLQAHGKKTPQIICYPEAGHYI 362

  Fly    79 TCIYVRCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYA 143
            ...|...||.|..:|               |.:.:                 :.||:| ..:..|
  Rat   363 EPPYFPWSKAAPNSL---------------FDMPI-----------------ILGGEP-RAHAMA 394

  Fly   144 DIEAAWQAMRTRFN 157
            .:: |||.::..|:
  Rat   395 QVD-AWQQLQIFFH 407

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33096	NP_001356926.1	FrsA	<92..280	CDD:223999	10/66 (15%)
Acot5	NP_001073177.1	Bile_Hydr_Trans	17..137	CDD:282610
		Abhydrolase	137..>253	CDD:304388
		BAAT_C	205..412	CDD:285986	33/144 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1073
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900