DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and abhd17b

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001002744.1 Gene:abhd17b / 437017 ZFINID:ZDB-GENE-040718-244 Length:166 Species:Danio rerio


Alignment Length:157 Identity:111/157 - (70%)
Similarity:130/157 - (82%) Gaps:1/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SISELCCMFCCPPCPGPIAAKLAFQPPEPTYKLTPADDTNIRYNLQLFDRAEWQYSEREKSKVEA 67
            |:|||||:|||||||..||:||||.||||||.|. .|::..|:.|.|.:||:|||:.|||..:|.
Zfish     5 SLSELCCLFCCPPCPSRIASKLAFLPPEPTYTLM-CDESGSRWTLHLSERADWQYTAREKDAIEC 68

  Fly    68 FFTRTSRGNLITCIYVRCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMS 132
            |.|||||||.|.|::||||.||:||||||||||||||||||||:.|||:||||:|.|||||||.|
Zfish    69 FMTRTSRGNRIACMFVRCSPNARYTLLFSHGNAVDLGQMSSFYIGLGSRINCNVFSYDYSGYGAS 133

  Fly   133 GGKPSEKNLYADIEAAWQAMRTRFNIS 159
            .|||||||||||::|||.|:|||..||
Zfish   134 SGKPSEKNLYADVDAAWHALRTRSMIS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 55/68 (81%)
abhd17bNP_001002744.1 FrsA <93..>156 CDD:223999 51/62 (82%)
Abhydrolase_5 93..>148 CDD:289465 46/54 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5654
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000445
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.