DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and Abhd12b

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001382659.1 Gene:Abhd12b / 408202 RGDID:1303145 Length:361 Species:Rattus norvegicus


Alignment Length:298 Identity:71/298 - (23%)
Similarity:115/298 - (38%) Gaps:85/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DTNIRYNLQLFDRAE-------WQ-----YSEREKSKVEAFFTRTSR-GNLITCIYVRCSKNAKY 91
            :|.|.:.:..|.|:|       |.     ..|..|.|...::....| ||.|             
  Rat    89 ETKIAHTVNFFLRSEPGVLLGIWHTVPSCRGEEAKGKCRCWYKAALRDGNPI------------- 140

  Fly    92 TLLFSHGNA--------VDLGQMSS---FYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADI 145
             :::.||:|        :.|.|:.|   |:          :...||.|:|.|.|.|:|:.|..|.
  Rat   141 -IVYLHGSAEHRAAPPRIKLAQVLSDGGFH----------VLSVDYRGFGDSTGTPTEEGLTTDA 194

  Fly   146 EAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHE-----VGAVILHSPLMS--------GL 197
            ...::..:||...:|  :.|:|.|:||....:.|...|     |.|::|.:|..:        .|
  Rat   195 VCVYEWAKTRSGGTP--VCLWGHSLGTGVATNAARALEAKGYPVDAIVLEAPFTNMWVASINYPL 257

  Fly   198 RVVFRNTKR--TWFFDA-------FPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYE------ 247
            ..:::...|  ....||       ||:.:.|..:.:|:|::||.||..:...:|..:||      
  Rat   258 LKIYQKLPRCLRTLMDAFKEDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKQLYEIARSAY 322

  Fly   248 ----RCPKTVEPFWVEGAGHNDVELHPHYYERLRKFLS 281
                |....|.|   .|..||.:...|.....:|.|||
  Rat   323 RNKDRVKMVVFP---PGYHHNLLCESPMLIRSVRDFLS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 55/230 (24%)
Abhd12bNP_001382659.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.