DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and Acot6

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001292214.1 Gene:Acot6 / 299193 RGDID:1309669 Length:422 Species:Rattus norvegicus


Alignment Length:30 Identity:12/30 - (40%)
Similarity:20/30 - (66%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SGYGMSGGKPSEKNLYADIEAAWQAMRTRF 156
            ||..:|||:|..:: .|.:: |||.::|.|
  Rat   380 SGPILSGGEPRAQS-RAQLD-AWQRIQTFF 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 12/30 (40%)
Acot6NP_001292214.1 Bile_Hydr_Trans 17..137 CDD:282610
Aes 83..373 CDD:223730
BAAT_C 203..413 CDD:285986 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.