DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and ABHD12

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_056415.1 Gene:ABHD12 / 26090 HGNCID:15868 Length:404 Species:Homo sapiens


Alignment Length:275 Identity:69/275 - (25%)
Similarity:109/275 - (39%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CPGPIAAKLAF-------------QPPEP------TYKLTPADDTNIRYNLQLFDRAEWQYSERE 61
            ||| |.|||.|             :|.:.      .|.|.|.:|..|         ..|.     
Human    93 CPG-IQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTI---------GVWH----- 142

  Fly    62 KSKVEAFFTRTSRGNLITCIYVRCSKNAKYTLLFSHGNAVDLG--QMSSFYLTLGSQINCNIFGY 124
              .|.|.:.:.::|. ....|.....::...:|:.||||...|  .....|..| |.:..::..:
Human   143 --TVPAVWWKNAQGK-DQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVL-SSLGYHVVTF 203

  Fly   125 DYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASR---HEV-- 184
            ||.|:|.|.|.|||:.:..|....:..::.|...:|  :.::|.|:||....:|..|   .|.  
Human   204 DYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNP--VYIWGHSLGTGVATNLVRRLCERETPP 266

  Fly   185 GAVILHSPLMSGLR---------VVFRNTKR-TWFF--------DAFPSIDKVAKVKAPVLVIHG 231
            .|:||.|| .:.:|         |::|.... .|||        ..|.:.:.|..:..|:|::|.
Human   267 DALILESP-FTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHA 330

  Fly   232 TDDEVIDFSHGIGIY 246
            .||.|:.|..|..:|
Human   331 EDDPVVPFQLGRKLY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 50/180 (28%)
ABHD12NP_056415.1 Hydrolase_4 165..351 CDD:403389 50/185 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.