DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and Abhd17b

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_666208.2 Gene:Abhd17b / 226016 MGIID:1917816 Length:288 Species:Mus musculus


Alignment Length:283 Identity:198/283 - (69%)
Similarity:240/283 - (84%) Gaps:1/283 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SISELCCMFCCPPCPGPIAAKLAFQPPEPTYKLTPADDTNIRYNLQLFDRAEWQYSEREKSKVEA 67
            |.|||||:||||||||.||:||||.||:|||.|. .|::..|:.|.|.:||:||||.|||..:|.
Mouse     5 SFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLM-CDESGSRWTLHLSERADWQYSSREKDAIEC 68

  Fly    68 FFTRTSRGNLITCIYVRCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMS 132
            |.||||:||.|.|::||||.|||||||||||||||||||||||:.|||:||||||.|||||||.|
Mouse    69 FMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGAS 133

  Fly   133 GGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHEVGAVILHSPLMSGL 197
            .|||:|||||||:||||.|:|||:.|.||.:|:|||||||||:||||:|:|..||||||||.||:
Mouse   134 SGKPTEKNLYADVEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGM 198

  Fly   198 RVVFRNTKRTWFFDAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPFWVEGAG 262
            ||.|.:||:|:.|||||:|||::|:.:|||:||||:|||||||||:.::|||.:.|||.||||||
Mouse   199 RVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAG 263

  Fly   263 HNDVELHPHYYERLRKFLSVELV 285
            ||||||:..|.|||::|:|.|||
Mouse   264 HNDVELYGQYLERLKQFVSQELV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 136/187 (73%)
Abhd17bNP_666208.2 FrsA <93..285 CDD:223999 138/191 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 189 1.000 Domainoid score I3287
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 433 1.000 Inparanoid score I1694
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45930
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000445
OrthoInspector 1 1.000 - - otm43713
orthoMCL 1 0.900 - - OOG6_100915
Panther 1 1.100 - - O PTHR12277
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R134
SonicParanoid 1 1.000 - - X362
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.950

Return to query results.
Submit another query.