DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and K05B2.4

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_508837.3 Gene:K05B2.4 / 187017 WormBaseID:WBGene00019404 Length:431 Species:Caenorhabditis elegans


Alignment Length:224 Identity:44/224 - (19%)
Similarity:75/224 - (33%) Gaps:82/224 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNLITCIYVR-------CSKNAKYTL-LFSH----------GNAVDLGQMSSFYLT---LGSQIN 118
            |.|:..:..|       ||.|..:|: .|:|          |..::.|....:||.   :.:.:.
 Worm   239 GTLVMFLTTRFKQIKAACSINGSFTMDEFAHVLIDGKQPPVGRFINQGIEDIWYLNDLMVYTDMV 303

  Fly   119 CNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTV------- 176
            .|:...|.:|:......|         |.|:     ||:::.:.:        :.|||       
 Worm   304 RNLKLEDGAGFKFEDSSP---------ETAF-----RFSLAVDDL--------STPTVFVGKVLS 346

  Fly   177 ----DLASRHEV----GAVILHSPLMSGLRVVFRNTKRTWFFDAFPSIDKVAKVKAPVLVIHGTD 233
                :|..:.||    |..:|..|                   .||..:.|....|.....:|.:
 Worm   347 EKLRNLNRKVEVHYVSGGHLLDPP-------------------CFPHHEAVFSAFAGTFQAYGGE 392

  Fly   234 DEVIDFSHGIGIYERCPKTVEPFWVEGAG 262
            ..:    ||...:|...|||: |:.|..|
 Worm   393 TSL----HGKSQFEVWEKTVQ-FFSEHLG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 38/200 (19%)
K05B2.4NP_508837.3 Bile_Hydr_Trans 16..133 CDD:282610
BAAT_C 208..417 CDD:285986 44/224 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.