DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and Acot3

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_599007.1 Gene:Acot3 / 171281 MGIID:2159619 Length:432 Species:Mus musculus


Alignment Length:169 Identity:40/169 - (23%)
Similarity:66/169 - (39%) Gaps:44/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PSIDKV----AKVKAPVLVIHGTD--DEVID-FSHGIGIYERCPKTV--EPFWVEGAGHNDVE-- 267
            |.:.:|    .:|:|.:.:..||.  ..:|| |..|.|:.|.....:  :.|.|....:|:.|  
Mouse   143 PGVRRVPVREGRVRATLFLPPGTGPFPGIIDLFGIGSGLLEYRASLLAGKGFAVMALAYNNYEDL 207

  Fly   268 ------LHPHYYERLRKFLSVELVKXQLKNNVDG--GVS--------------DTTSGVISNSNP 310
                  :|..|:|....:|   |...|:..:..|  |:|              :.|:.||.|.:.
Mouse   208 PKDMDIIHLEYFEEAVTYL---LSHPQVTGSGVGVLGISKGGELGFAMASFLKNITAAVIINGSI 269

  Fly   311 AAGSASLSSKHPNPAPAAGSETSKKNVDTNVKRIENDGL 349
            :....:|..| ....|:.|..|.:      |||.: |||
Mouse   270 SNIGGNLQYK-DETVPSVGINTKR------VKRTK-DGL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 19/82 (23%)
Acot3NP_599007.1 Bile_Hydr_Trans 28..148 CDD:282610 1/4 (25%)
Abhydrolase 148..>264 CDD:304388 25/118 (21%)
BAAT_C 214..423 CDD:285986 24/98 (24%)
Microbody targeting signal. /evidence=ECO:0000255 430..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.