DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and Acot2

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_598949.3 Gene:Acot2 / 171210 MGIID:2159605 Length:453 Species:Mus musculus


Alignment Length:272 Identity:49/272 - (18%)
Similarity:90/272 - (33%) Gaps:75/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GSQIN---CNIFGYDYSG---YGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGT 172
            |.::|   ....|..:||   .|:......|:.|:..|:   :.::|.|.:..|.:..:....|.
Mouse    98 GGELNLARAPALGGSFSGLEPMGLLWAMEPERPLWRLIK---RDVQTPFLVELEVLDGHEPDGGQ 159

  Fly   173 VPTVDLASRHEVGAVILHSPLMSGLRVVFRNTKRTWFF----DAFPSIDKVAKVKAPVLVIHGTD 233
            .....:..||.:...:...|:..|      ..:.|.|.    ..||.|          :.:.|..
Mouse   160 RLAQAVHERHFLAPGVRRVPVREG------RVRATLFLPPEPGPFPGI----------IDLFGVG 208

  Fly   234 DEVIDF------SHGIGI-------YERCPKTVEPFWVEGAGHNDVELHPHYYER----LRKFLS 281
            ..::::      ..|..:       |:..||::|            .:|..|:|.    ||....
Mouse   209 GGLLEYRASLLAGKGFAVMALAYYNYDDLPKSIE------------TMHMEYFEEAVNYLRSHPE 261

  Fly   282 VELVKXQLKNNVDGG---------VSDTTSGVISNSNPAAGSASLSSKHPNPAPAAGSETSKKNV 337
            |:.....|.....||         :...|:.|:.|.:.||...::|.|.....|.        ::
Mouse   262 VKGPGIGLLGISKGGELGLAMASFLKGITAAVVINGSVAAVGNTISYKDETIPPV--------SL 318

  Fly   338 DTNVKRIENDGL 349
            ..|..::..|||
Mouse   319 LRNQVKMTKDGL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 33/192 (17%)
Acot2NP_598949.3 Bile_Hydr_Trans 58..178 CDD:282610 15/82 (18%)
Abhydrolase 186..>298 CDD:304388 23/133 (17%)
BAAT_C 244..451 CDD:285986 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.