DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33096 and ABHD12B

DIOPT Version :9

Sequence 1:NP_001356926.1 Gene:CG33096 / 326251 FlyBaseID:FBgn0053096 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001193602.1 Gene:ABHD12B / 145447 HGNCID:19837 Length:362 Species:Homo sapiens


Alignment Length:238 Identity:62/238 - (26%)
Similarity:104/238 - (43%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CIYVRCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQIN---CNIFGYDYSGYGMSGGKPSEKNL 141
            |.|....::....:::.||:|..  :.:|..|.|...::   .::...||.|:|.|.|||:|:.|
Human   129 CWYEAALRDGNPIIVYLHGSAEH--RAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGL 191

  Fly   142 YADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHE-----VGAVILHSPLMS------ 195
            ..|....::..:.|..|:|  :.|:|.|:||....:.|...|     |.|::|.:|..:      
Human   192 TTDAICVYEWTKARSGITP--VCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASI 254

  Fly   196 --GLRVVFRNTK---RTWFFDA-------FPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIY-- 246
              .|..::||..   || ..||       ||:.:.|..:.:|:|::||.||..:...:|..:|  
Human   255 NYPLLKIYRNIPGFLRT-LMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEI 318

  Fly   247 --------ERCPKTVEPFWVEGAGHNDVELHPHYYERLRKFLS 281
                    ||....:.|   .|..||.:...|.....:|.|||
Human   319 ARNAYRNKERVKMVIFP---PGFQHNLLCKSPTLLITVRDFLS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33096NP_001356926.1 FrsA <92..280 CDD:223999 57/223 (26%)
ABHD12BNP_001193602.1 Hydrolase_4 141..343 CDD:288960 55/209 (26%)
Abhydrolase_5 142..324 CDD:289465 49/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.