DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and IQCH

DIOPT Version :9

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001026885.2 Gene:IQCH / 64799 HGNCID:25721 Length:1027 Species:Homo sapiens


Alignment Length:99 Identity:25/99 - (25%)
Similarity:36/99 - (36%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPPWTSYFVKFHDVANDQRGMSHFNWTLENGTNYHILRTACYPYMKYHCSKREVQDLWLEDKFFR 89
            |||.:...|||.......:|.|      .....:|..:.     ||.....|.::.||..| |..
Human   220 EPPPSPAEVKFFPKKQRSKGKS------RRSRGHHDRKA-----MKVKTPLRALKSLWDYD-FLI 272

  Fly    90 FLKVINLGLP--MLF---YGLA---AIRLISHTE 115
            :..||:...|  :.|   :.||   ...|:.|.|
Human   273 YDGVIDNTAPDFLAFKEHFSLAWGGIFSLLEHVE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 25/99 (25%)
IQCHNP_001026885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..252 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1007..1027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28K0M
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.