DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and iqch

DIOPT Version :9

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_005159189.1 Gene:iqch / 567336 ZFINID:ZDB-GENE-050419-242 Length:1082 Species:Danio rerio


Alignment Length:95 Identity:23/95 - (24%)
Similarity:31/95 - (32%) Gaps:46/95 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLTRLLLKPRASEV---LTAYLKQCH--EPPWT-------------------SYFVKF-----H 36
            |::.|.|.| ..|||   .|||:..||  ..||.                   |..:||     |
Zfish   684 MEVQRWLFK-IDSEVGGRGTAYVDVCHLKSRPWAQQEFIRHEPQQWRTSQSQDSVMIKFLEEVPH 747

  Fly    37 DVANDQRGMSHFNWTLENGTNYHILRTACY 66
            .:|:..|                :..|:||
Zfish   748 LLASYAR----------------LANTSCY 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 20/87 (23%)
iqchXP_005159189.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28K0M
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.