DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and RGD1309779

DIOPT Version :9

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001102236.1 Gene:RGD1309779 / 363074 RGDID:1309779 Length:157 Species:Rattus norvegicus


Alignment Length:149 Identity:73/149 - (48%)
Similarity:93/149 - (62%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTRLLL------------KPRASEVLTAYLKQCHEPPWTSYFVKFHDVANDQRGMSHFNWTLENG 55
            :.||||            |||||||||.:|.|...|.|||:.|.:..|.|||.|:|||||.:. |
  Rat    11 MLRLLLWGPWASGAASRPKPRASEVLTRHLLQRRLPHWTSFCVPYSAVHNDQFGLSHFNWPVP-G 74

  Fly    56 TNYHILRTACYPYMKYHCSKREVQDLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVS 120
            .|||:|||.|:|::||||||...|||..:::||..|||||:|:|.|.|||.:......||.||.|
  Rat    75 ANYHVLRTGCFPFIKYHCSKAPWQDLAAQNRFFTALKVINMGIPTLLYGLGSWLFAKVTETVHTS 139

  Fly   121 ETVKVPIYFLYPEDKGSSF 139
            .. .:.||||..||:|:.:
  Rat   140 YG-PITIYFLNKEDEGAMY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 68/126 (54%)
RGD1309779NP_001102236.1 DUF4528 29..154 CDD:405682 68/126 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344921
Domainoid 1 1.000 132 1.000 Domainoid score I4967
eggNOG 1 0.900 - - E1_28K0M
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H19058
Inparanoid 1 1.050 133 1.000 Inparanoid score I4498
OMA 1 1.010 - - QHG49563
OrthoDB 1 1.010 - - D1465932at2759
OrthoFinder 1 1.000 - - FOG0007857
OrthoInspector 1 1.000 - - oto97475
orthoMCL 1 0.900 - - OOG6_109901
Panther 1 1.100 - - LDO PTHR34651
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5812
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.