DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and C15orf61

DIOPT Version :9

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001137408.1 Gene:C15orf61 / 145853 HGNCID:34453 Length:157 Species:Homo sapiens


Alignment Length:147 Identity:71/147 - (48%)
Similarity:92/147 - (62%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLLL------------KPRASEVLTAYLKQCHEPPWTSYFVKFHDVANDQRGMSHFNWTLENGTN 57
            ||||            ||.||||||.:|.|...|.|||:.|.:..|.|||.|:|||||.:: |.|
Human    13 RLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQ-GAN 76

  Fly    58 YHILRTACYPYMKYHCSKREVQDLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVSET 122
            ||:|||.|:|::||||||...|||..:::||..|||:|||:|.|.|||.:......||.||.|..
Human    77 YHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSYG 141

  Fly   123 VKVPIYFLYPEDKGSSF 139
             .:.:|||..||:|:.:
Human   142 -PITVYFLNKEDEGAMY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 66/126 (52%)
C15orf61NP_001137408.1 DUF4528 29..154 CDD:373491 66/126 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151428
Domainoid 1 1.000 135 1.000 Domainoid score I4996
eggNOG 1 0.900 - - E1_28K0M
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H19058
Inparanoid 1 1.050 136 1.000 Inparanoid score I4570
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49563
OrthoDB 1 1.010 - - D1465932at2759
OrthoFinder 1 1.000 - - FOG0007857
OrthoInspector 1 1.000 - - oto90360
orthoMCL 1 0.900 - - OOG6_109901
Panther 1 1.100 - - LDO PTHR34651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5034
SonicParanoid 1 1.000 - - X5812
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.