DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34148 and zgc:162898

DIOPT Version :9

Sequence 1:NP_788708.2 Gene:CG34148 / 326250 FlyBaseID:FBgn0083984 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001076422.1 Gene:zgc:162898 / 100003490 ZFINID:ZDB-GENE-070410-107 Length:156 Species:Danio rerio


Alignment Length:132 Identity:68/132 - (51%)
Similarity:91/132 - (68%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKPRASEVLTAYLKQCHEPPWTSYFVKFHDVANDQRGMSHFNWTLENGTNYHILRTACYPYMKYH 72
            ::|.||||||.:|.|...|||||:.|::.||.|||.|:|:|||.:: |||||||||..:|::|||
Zfish    27 VRPSASEVLTCHLTQRALPPWTSFCVRYRDVINDQFGLSNFNWQVQ-GTNYHILRTGAFPFIKYH 90

  Fly    73 CSKREVQDLWLEDKFFRFLKVINLGLPMLFYGLAAIRLISHTEIVHVSETVKVPIYFLYPEDKGS 137
            |:|...|:|..|:.||..|||||||:|.|.|||.:..::..||.|..| ...|.:||.|.|.:|:
Zfish    91 CTKAPPQNLQFENTFFGALKVINLGIPCLAYGLGSWMVVGVTETVQTS-AGPVTVYFAYKEAEGA 154

  Fly   138 SF 139
            .|
Zfish   155 QF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34148NP_788708.2 DUF4528 9..136 CDD:291690 66/126 (52%)
zgc:162898NP_001076422.1 DUF4528 28..153 CDD:291690 66/126 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585906
Domainoid 1 1.000 133 1.000 Domainoid score I5036
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H19058
Inparanoid 1 1.050 138 1.000 Inparanoid score I4507
OMA 1 1.010 - - QHG49563
OrthoDB 1 1.010 - - D1465932at2759
OrthoFinder 1 1.000 - - FOG0007857
OrthoInspector 1 1.000 - - oto40844
orthoMCL 1 0.900 - - OOG6_109901
Panther 1 1.100 - - LDO PTHR34651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5034
SonicParanoid 1 1.000 - - X5812
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.