DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and HFD1

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_013828.1 Gene:HFD1 / 855137 SGDID:S000004716 Length:532 Species:Saccharomyces cerevisiae


Alignment Length:410 Identity:101/410 - (24%)
Similarity:171/410 - (41%) Gaps:53/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 GFVAAISPFNFTGIAANLAYTPAL-MGNSVIWKPSD-----SAILSNYFVFKALREAGVPDGVVN 279
            |.|..|:||||..:.|......|| .||:::.|||:     :.::.|     .|..||.|||::.
Yeast   130 GSVLIIAPFNFPLLLAFAPLAAALAAGNTIVLKPSELTPHTAVVMEN-----LLTTAGFPDGLIQ 189

  Fly   280 FVPA--EETTFASVVTQHPKLAGINFTGTSTVLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFV 342
            .|..  :|||   .:....|...|.:||:..|..::.:..|:::.      ..|.|.|||:..|:
Yeast   190 VVQGAIDETT---RLLDCGKFDLIFYTGSPRVGSIVAEKAAKSLT------PCVLELGGKSPTFI 245

  Fly   343 ---HSSAEPETAVACTIRAAFEYAGQKCSSCSMLYVPESLWQNHIRE---PLLEITASLVVRQDA 401
               ..::..:.|:......||..:||.|.|...|.|.:|::...|:|   .|.|...|...:.|.
Yeast   246 TENFKASNIKIALKRIFFGAFGNSGQICVSPDYLLVHKSIYPKVIKECESVLNEFYPSFDEQTDF 310

  Fly   402 TYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQILVGGSCDKRRGYYVDPTVVLVKDLDNIICRE 466
            |       .:|:..||.:....:...:.|......:..:.|......|.||:|.....|:.:.::
Yeast   311 T-------RMIHEPAYKKAVASINSTNGSKIVPSKISINSDTEDLCLVPPTIVYNIGWDDPLMKQ 368

  Fly   467 ELLAPILGVYVYPDHKLKETMEKVAQINHG--LTGSVFAQDQNFIEEAYDAFRVNVGNLNVNDKS 529
            |..||:|.:..|.|  |.||:.|:.: .|.  |...:|:..|..|.....  |:..|:..|.|..
Yeast   369 ENFAPVLPIIEYED--LDETINKIIE-EHDTPLVQYIFSDSQTEINRILT--RLRSGDCVVGDTV 428

  Fly   530 TGLMVGQQPFGAGHMTGTS--DKLGTPHSLLRWTSPQVI-KESYKTHRNIFYPYMQINDQEQGIA 591
            ..:.:...|||.   .|||  ...|..:....::..:.| |:.|.....:|..|...:.|::.:.
Yeast   429 IHVGITDAPFGG---IGTSGYGNYGGYYGFNTFSHERTIFKQPYWNDFTLFMRYPPNSAQKEKLV 490

  Fly   592 QSDMVSQDESSFGHFNSDGN 611
            :..|..:.     .|:.:||
Yeast   491 RFAMERKP-----WFDRNGN 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 93/367 (25%)
HFD1NP_013828.1 ALDH-SF 11..466 CDD:416387 92/364 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.