DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and ALDH8A1

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_072090.1 Gene:ALDH8A1 / 64577 HGNCID:15471 Length:487 Species:Homo sapiens


Alignment Length:476 Identity:110/476 - (23%)
Similarity:189/476 - (39%) Gaps:97/476 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAE-MDVAEL 183
            |:.|:..:.||...|......:|..:..:.|.|:..... ....|....|||||..|. ||:...
Human    47 IEAAVKAAREAFPSWSSRSPQERSRVLNQVADLLEQSLE-EFAQAESKDQGKTLALARTMDIPRS 110

  Fly   184 VDFMRINPVFLRELANYEPIRDIQNNCRNSMR--LRGLSGFVAAISPFNFTGIAANLAYTPAL-M 245
            |...|    |....:.:......|.:....|.  :|...|....|||:|...........||: .
Human   111 VQNFR----FFASSSLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAA 171

  Fly   246 GNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTSTVL 310
            ||:||.|||:...::.:.:.|.|.:||||.||||.|..........:..||::..|:|||:....
Human   172 GNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTA 236

  Fly   311 KVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSMLYV 375
            :.:.||.|.:..      :|..|.||||...:...|..:..:..|:|::|...|:.|...|.::|
Human   237 ERITQLSAPHCK------KLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFV 295

  Fly   376 PESLWQNHIR---------------EPLLEITASLVVRQDATYCDSFCSAVINRRAYDRIYMWLR 425
            .:|::...::               :||:.|                 .|:|::...:::..:::
Human   296 QKSIYSEFLKRFVEATRKWKVGIPSDPLVSI-----------------GALISKAHLEKVRSYVK 343

  Fly   426 YIDQSPSCQILVGGSCDK-------RRGYYVDPTVVL-VKDLDNIICREELLAPILGVYVYPDHK 482
            .. .:...||..|...||       :.||::.|||:. :|| ::....||:..|:  ..|.|...
Human   344 RA-LAEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKD-ESCCMTEEIFGPV--TCVVPFDS 404

  Fly   483 LKETMEKVAQINHGLTGSVFAQDQNFIEEAYDAFRVNVGNLNVNDKSTGLMVGQQPFGAGHMTGT 547
            .:|.:|:...:.:||..:|::.              |||.::                     ..
Human   405 EEEVIERANNVKYGLAATVWSS--------------NVGRVH---------------------RV 434

  Fly   548 SDKLGTPHSLLRWTSPQVIKE 568
            :.||   .|.|.||:..:|:|
Human   435 AKKL---QSGLVWTNCWLIRE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 110/476 (23%)
ALDH8A1NP_072090.1 ALDH_F8_HMSADH 27..485 CDD:143412 110/476 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.