DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and ALDH7A1

DIOPT Version :10

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001173.2 Gene:ALDH7A1 / 501 HGNCID:877 Length:539 Species:Homo sapiens


Alignment Length:106 Identity:25/106 - (23%)
Similarity:38/106 - (35%) Gaps:28/106 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ANGRKRHSSINEQQLVPLEPPPGSCLSSPTAPPPPPAGSGT----------------GRCYQSSL 51
            :|.|..::...:||..|.:|||..  ..|..|||||:.|..                |....:|.
Human   585 SNNRGNYNRAPQQQPPPQQPPPPQ--PPPQQPPPPPSYSPARNPPGASSYNKNSNIPGSSANTST 647

  Fly    52 RSYSKWSPTEQGATLVWRDLCVYATAGPAKGGGCGGGGGPP 92
            .:.|.::|.:..          |:.....:||...|...||
Human   648 PTVSSYTPPQPS----------YSQPPYNQGGYTQGYTAPP 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:448367 9/43 (21%)
ALDH7A1NP_001173.2 ALDH_F7_AASADH 53..527 CDD:143448
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.