DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and Aldh16a1

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001028878.1 Gene:Aldh16a1 / 361571 RGDID:1566295 Length:802 Species:Rattus norvegicus


Alignment Length:234 Identity:50/234 - (21%)
Similarity:94/234 - (40%) Gaps:50/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IQMAIDKSVEAQVKWDKVRLSDRID-IWERAAMLIAGRYRYNIIAATM--LGQGKTLRQAEMDVA 181
            |:.|::.:.:|...|.......|.. :|..||.|   ..|..::||.:  .|...|:.:.|::::
  Rat   566 IRGAVEAAHQAAPGWGAQSPRARASLLWALAAAL---ERRKQVLAAQLERHGAAPTVAETEVELS 627

  Fly   182 ELVDFMRINPVFLRELANYEP-IRDIQNNCRNS------MRLRGLSGFVAAISPFNFTGIAANLA 239
                        :|.|..:.. ::|.....:.:      :|||...|.:|.:.|..:..:|....
  Rat   628 ------------VRRLQTWATRVQDQGQTLQVTGLRGPVLRLREPLGVLAVVCPDEWPMLAFVSL 680

  Fly   240 YTPALM-GNSVIWKPSDSAILSNYFVFKALRE--AGVPDGVVNFVPAEETTFASVVTQHPKLAGI 301
            ..|||. ||:|:..||.|..|   ...:|.::  |..|.|:||.|..:.......:..|..:..:
  Rat   681 LAPALAHGNAVVLVPSGSCPL---LALEACQDIAALFPAGLVNVVTGDRDHLTRCLALHQDVQAM 742

  Fly   302 NFTGTST-----------VLKVLWQLVAQNINFYQNYPR 329
            .:.|::.           .||.:|      :|  :::||
  Rat   743 WYFGSAQGSQFVEWASAGNLKPVW------VN--RDFPR 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 50/234 (21%)
Aldh16a1NP_001028878.1 ALDH-SF 19..491 CDD:416387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..554
ALDH-SF 550..>765 CDD:416387 46/216 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.