DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and CG11634

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001286129.1 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster


Alignment Length:284 Identity:57/284 - (20%)
Similarity:99/284 - (34%) Gaps:83/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SKRPELSEH---FTLD-----EMVANEKLLQYDEGSKERTELETALLG--VLNRVEHVPIVINGQ 89
            |:.|..|||   .:||     :||.|.:....|....|.|......:|  |.:..:.:.|...| 
  Fly    14 SEHPSQSEHNESLSLDHVVTYDMVHNPEGRSPDHSVIEMTSEADRHIGHDVTSSPQLMIIFEEG- 77

  Fly    90 EFQAKEDFQQVLPYDIQQPIAHYGHAHRVLIQMAIDKSVEAQVKWDKVRLSDRID-----IWERA 149
                  |....|.:.|:.  .|...|...:..:.:::.:..::   ..|:..::.     :.|..
  Fly    78 ------DINSALHFIIES--VHNPFASNAVAMVLVEEKIRGEI---VERILSKLHPLSKFVAEHP 131

  Fly   150 AMLIA----GRYRYNIIAATMLGQGKTLRQAEMDVAELVDFMRINPVFL-----RELANYE---- 201
            :.|.|    ....:|||.|.              ::|:...| .:|:|:     .:|.:|.    
  Fly   132 SYLAALEKCHTSNFNIIRAC--------------ISEVAPPM-ASPIFVCDCTHDKLGSYPTGVV 181

  Fly   202 PIRDIQNN--------CRN---------SMRLRGLSGFVAAISPFNFTGIAANLAYTPALMGNSV 249
            .....:||        |.:         :..|.|....|||:|...|....||:..:|.|     
  Fly   182 TFHTFRNNQEAIAISQCESLAFASVSIWNETLTGCYDLVAALSSSYFFLNCANVDLSPIL----- 241

  Fly   250 IWKP----SDSAILSNYFVFKALR 269
              ||    .:..::.|.|.|:.||
  Fly   242 --KPHKAQKNYVVVENGFHFETLR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 49/261 (19%)
CG11634NP_001286129.1 DUF1487 64..279 CDD:254173 43/234 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.