DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and CG31274

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:150 Identity:22/150 - (14%)
Similarity:47/150 - (31%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 IRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPALMGNSVIWKPSDSAILSNYFVFKA 267
            :.::..||.|...|..|                 |..|...|:....:.|    .|..|.:.|..
  Fly    21 LTEVLRNCANIQSLESL-----------------NYEYNDVLLTEDNVGK----MITPNPYSFSG 64

  Fly   268 LREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTSTVLKVLWQLVAQNINFYQNYPRLVG 332
                   :..::..|:|:.:|:..:.:......:.:....|:.:.|....|....|..     :.
  Fly    65 -------NISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLD-----LS 117

  Fly   333 EGGGKNFHFVHSSAEPETAV 352
            ....:|..|:....:.:|.:
  Fly   118 HNDFRNLRFLSFFEDLDTLI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 22/149 (15%)
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 3/25 (12%)
leucine-rich repeat 133..154 CDD:275378 1/4 (25%)
leucine-rich repeat 155..181 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.